Invitrogen™ Human OLIG2 (aa 14-126) Control Fragment Recombinant Protein

Product Code. 30202604

Brand: Invitrogen™ RP100729

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Tissue specificity: Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas highly variable.

Specifications

• Accession Number: Q13516
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10215
• Name: Human OLIG2 (aa 14-126) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI604895; basic domain, helix-loop-helix protein, class B, 1; Basic helix loop helix protein class B1 (bHLHB1); basic helix-loop-helix protein 19 (bHLHe19); bHLH transcription factor; BHLHB1; bHLHe19; Class B basic helix-loop-helix protein 1; class E basic helix-loop-helix protein 19; human protein kinase C-binding protein RACK17; Olg-2; OLIG2; olig-2; Oligo2; Oligo2 antibody; oligodendrocyte lineage transcription factor 2; Oligodendrocyte specific bHLH transcription factor 2; oligodendrocyte transcription factor 2; oligodendrocyte-specific bHLH transcription factor 2; PRKCBP2; Protein kinase C-binding protein 2; Protein kinase C-binding protein 2 (PRKCBP2); Protein kinase C-binding protein RACK17; RACK17; RK17; wu:fc64g09
• Common Name: OLIG2
• Gene Symbol: OLIG2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining