Invitrogen™ Human OLFML2A (aa 355-436) Control Fragment Recombinant Protein

Product Code. 30203365

Brand: Invitrogen™ RP93075

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54343 (PA5-54343. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OLFML2A contains one olfactomedin-like domain. Its exact function is unknown. There are three named isoforms produced by alternative splicing.

Specifications

• Accession Number: Q68BL7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 169611
• Name: Human OLFML2A (aa 355-436) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932431K08Rik; mFLJ00237; olfactomedin like 2 A; olfactomedin-like 2 A; olfactomedin-like protein 2 A; OLFML2A; Photomedin-1; PRO34319; UNQ9394/PRO34319
• Common Name: OLFML2A
• Gene Symbol: OLFML2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTSIPATTTTATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRHEGAWMKDPAARDDRIYVTNYYY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining