Invitrogen™ Human OLFM4 (aa 168-253) Control Fragment Recombinant Protein

Código de producto. 30202747

Marca: Invitrogen™ RP108295

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85041 (PA5-85041. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OLFM4 is a 510 amino acid extracellular matrix glycoprotein belonging to the olfactomedin-related protein family and found to be selectively expressed in inflammed colonic epithelium. It has one signal peptide, six N-linked glycosylation motif and forms disulfide-bonded multimers. OLFM4 a transcription factor may have a matrix-related function in differentiation. Constitutively expressed OLFM4 in cancer cells binds to the potent apoptosis inducer GRIM-19 and has a novel antiapoptotic action and hence might serve as a diagnostic marker for human cancers. Reports suggest that OLFM4 promotes proliferation of PANC-1 cells by favoring transition from the S to G2/M phase. Potential interaction of OLFM4 with endogenous cell surface lectins and cadherins may mediate cell adhesion.

Especificaciones

• Accession Number: Q6UX06
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10562
• Name: Human OLFM4 (aa 168-253) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Antiapoptotic protein GW112; bA209J19.1; GC1; G-CSF-stimulated clone 1 protein; Gm296; Gm913; GW112; hGC-1; hOLfD; olfactomedin 4; olfactomedin-4; OlfD; OLFM4; OLM4; pPD4; PU0.1 difference product 4; UNQ362; UNQ362/PRO698
• Common Name: OLFM4
• Gene Symbol: OLFM4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining