missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202747

Invitrogen™ Human OLFM4 (aa 168-253) Control Fragment Recombinant Protein

Product Code. 30202747
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202747

Brand: Invitrogen™ RP108295

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85041 (PA5-85041. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OLFM4 is a 510 amino acid extracellular matrix glycoprotein belonging to the olfactomedin-related protein family and found to be selectively expressed in inflammed colonic epithelium. It has one signal peptide, six N-linked glycosylation motif and forms disulfide-bonded multimers. OLFM4 a transcription factor may have a matrix-related function in differentiation. Constitutively expressed OLFM4 in cancer cells binds to the potent apoptosis inducer GRIM-19 and has a novel antiapoptotic action and hence might serve as a diagnostic marker for human cancers. Reports suggest that OLFM4 promotes proliferation of PANC-1 cells by favoring transition from the S to G2/M phase. Potential interaction of OLFM4 with endogenous cell surface lectins and cadherins may mediate cell adhesion.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6UX06
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10562
Name Human OLFM4 (aa 168-253) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Antiapoptotic protein GW112; bA209J19.1; GC1; G-CSF-stimulated clone 1 protein; Gm296; Gm913; GW112; hGC-1; hOLfD; olfactomedin 4; olfactomedin-4; OlfD; OLFM4; OLM4; pPD4; PU0.1 difference product 4; UNQ362; UNQ362/PRO698
Common Name OLFM4
Gene Symbol OLFM4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.