Invitrogen™ Human OIP5 (aa 19-127) Control Fragment Recombinant Protein

Artikelnummer. 30209286

missing translation for 'mfr': Invitrogen™ RP105134

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66269 (PA5-66269. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.

Spezifikation

• Accession Number: O43482
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11339
• Name: Human OIP5 (aa 19-127) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730547N13Rik; cancer/testis antigen 86; CT86; hMIS18beta; LAP2alpha interactor-25; LINT-25; MIS18 kinetochore protein homolog B; MIS18B; MIS18beta; OIP5; OIP-5; Opa interacting protein 5; opa-interacting protein 5; Protein Mis18-beta; RGD1564263
• Common Name: OIP5
• Gene Symbol: OIP5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining