Invitrogen™ Human ODF3 (aa 26-101) Control Fragment Recombinant Protein

Product Code. 30195769

Brand: Invitrogen™ RP97513

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58709 (PA5-58709. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Outer dense fibers are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail. May help to maintain the passive elastic structures and elastic recoil of the sperm tail.

Specifications

• Accession Number: Q96PU9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 113746
• Name: Human ODF3 (aa 26-101) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700011O04Rik; Beta390; cancer/testis antigen 135; CT135; Odf3; outer dense fiber of sperm tails 3; outer dense fiber of sperm tails protein 3; Outer dense fiber protein 3; SHIPPO1; Sperm tail protein SHIPPO 1; sperm tail protein SHIPPO1; TISP50; Transcript induced in spermiogenesis protein 50
• Common Name: ODF3
• Gene Symbol: Odf3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining