Invitrogen™ Human ODF2 (aa 39-181) Control Fragment Recombinant Protein

Product Code. 30205977

Brand: Invitrogen™ RP101019

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51649 (PA5-51649. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly.

Specifications

• Accession Number: Q5BJF6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4957
• Name: Human ODF2 (aa 39-181) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 84 kDa outer dense fiber protein; AI848335; cancer/testis antigen 134; cenexin; cenexin 1; CT134; KKT4; MMTEST29; ODF2; ODF2/1; ODF2/2; Odf84; outer dense fiber of sperm tail 2; outer dense fiber of sperm tails 2; outer dense fiber of sperm tails protein 2; outer dense fiber of sperm tails, 84-kD; outer dense fiber protein 2; RP11-187B3.1; sperm outer dense fiber major protein 2; sperm tail structural protein; testis tissue sperm-binding protein Li 51 e; testis-specific autoantigen
• Common Name: ODF2
• Gene Symbol: ODF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining