Invitrogen™ Human Oct-2 (aa 1-51) Control Fragment Recombinant Protein

Product Code. 30210318

Brand: Invitrogen™ RP107131

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OCT-2 is a transcription factor belonging to the POU homeo-domain family that binds to the Ig gene octamer sites regulating B cell specific genes. OCT-2 protein expression is not restricted to B cells, although expression levels are much higher in these cells. OCT-2 expression is reported to be significantly greater in germinal center derived lymphomas, although other B cell lymphomas also display high levels of expression.

Specifications

• Accession Number: P09086
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5452
• Name: Human Oct-2 (aa 1-51) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2-Oct; homeobox protein; lymphoid-restricted immunoglobulin octamer-binding protein NF-A2; OCT2; Oct-2; Oct2a; Oct2b; octamer-binding protein 2; Octamer-binding transcription factor 2; OTF2; OTF-2; POU class 2 homeobox 2; POU domain, class 2, transcription factor 2; Pou2f2
• Common Name: Oct-2
• Gene Symbol: POU2F2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining