missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182453

Invitrogen™ Human OCIAD2 (aa 4-55) Control Fragment Recombinant Protein

Product Code. 30182453
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182453

Brand: Invitrogen™ RP98482

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59421 (PA5-59421. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OCIAD2 was identified by its sequence similarity with OCIAD1, and together OCIAD1 and OCIAD2 form the OCIA domain family. OCIAD2 mRNA was found to be expressed at higher levels in invasive adenocarcinoma mixed subtype with bronchioloalveolar carcinoma component (BAC) of the lung. Loss of OCIAD2 expression was significantly correlated with lymphatic invasion, blood vessel invasion, and lymph node metastasis, indicating that OCIAD2 may play a role in cell adhesion and prevention of cell migration. While the function of OCIAD2 is still unknown, its expression in adenocarcinoma with BAC component is significantly associated with a favorable prognosis and may serve as a marker for selecting tumors that are treatable by limited surgery.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q56VL3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 132299
Name Human OCIAD2 (aa 4-55) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810027I20Rik; OCIA domain containing 2; OCIA domain-containing protein 2; OCIAD2; Ovarian carcinoma immunoreactive antigen-like protein
Common Name OCIAD2
Gene Symbol OCIAD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.