missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210176

Invitrogen™ Human OCC1 (aa 1-62) Control Fragment Recombinant Protein

Product Code. 30210176
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210176

Brand: Invitrogen™ RP103594

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64212 (PA5-64212. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OCC-1 (Overexpressed in colon carcinoma-1) was initially identified as a novel human cDNA overexpressed in a colon carcinoma cell line. Elevated levels of OCC-1 mRNA were observed in three of eight colon carcinomas, suggesting that OCC-1 may be a hallmark of only a subset of colon carcinomas. It is highly expressed in skeletal muscle, kidney, placenta, and pancreas tissues, with low to no expression in heart, brain, lung and liver tissues. At least two different OCC-1 mRNA species are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TAD7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 387882
Name Human OCC1 (aa 1-62) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias adipogenesis down-regulated 3; AGD3; C12orf75; chromosome 12 open reading frame 75; OCC1; OCC-1; Overexpressed in colon carcinoma 1 protein; overexpressed in colon carcinoma-1; putative overexpressed in colon carcinoma-1 protein variant C
Common Name OCC1
Gene Symbol C12orf75, OCC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.