Invitrogen™ Human OBFC2B (aa 108-141) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30213188	100 μL	100µL

Product Code. 30213188 Supplier Invitrogen™ Supplier No. RP106757

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66064 (PA5-66064. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.

Specifications

• Accession Number: Q9BQ15
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79035
• Name: Human OBFC2B (aa 108-141) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610036N15Rik; hSSB1; LP3587; Nabp2; nucleic acid binding protein 2; nucleic acid-binding protein 2; Obfc2b; oligonucleotide/oligosaccharide-binding fold containing 2 B; oligonucleotide/oligosaccharide-binding fold-containing protein 2 B; RGD1308158; Sensor of single-strand DNA complex subunit B1; sensor of ssDNA subunit B1; single strand DNA-binding protein 1; single-stranded DNA-binding protein 1; SOSS complex subunit B1; SOSS-B1; SSB1
• Common Name: OBFC2B
• Gene Symbol: NABP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining