Invitrogen™ Human OAZ3 (aa 179-235) Control Fragment Recombinant Protein

Product Code. 30202165

Brand: Invitrogen™ RP105822

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65056 (PA5-65056. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The antizyme family is a group of small proteins that play a role in cell growth and division by regulating the biosynthesis of polyamines such as putrescine, spermidine and spermine. AZ3, also known as OAZ3 (Ornithine decarboxylase antizyme 3), is a 187 amino acid protein that belongs to the ODC antizyme family. AZ3 probably plays a key role in spermatogenesis by regulating the intracellular concentration of polyamines in haploid germ cells because it binds to, and destabilizes, ornithine decarboxylase. However, mutations in the AZ3 gene are not a common cause of male infertility and the normal AZ3 protein does not accelerate ornithine decarboxylase degeneration. AZ3 expression has a sharp onset in early spermatids, peaks in later stages and is gone in spermatozoa.

Specifications

• Accession Number: Q9UMX2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51686
• Name: Human OAZ3 (aa 179-235) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: antizyme 3; AZ3; Az-3; OAZ3; OAZ-t; ODC-Az 3; ornithine decarboxylase antizyme 3; testicular secretory protein Li 31; testis specific ornithine decarboxylase antizyme; TISP15
• Common Name: OAZ3
• Gene Symbol: OAZ3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VNFQNDRNDRGALLRAFSYMGFEVVRPDHPALPPLDNVIFMVYPLERDVGHLPSEPP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining