Invitrogen™ Human OATP1 (aa 265-315) Control Fragment Recombinant Protein

Product Code. 30202031

Brand: Invitrogen™ RP105520

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67149 (PA5-67149. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The organic anion transporting polypeptides, OATP-A (also designated OATP1, OATP1A2 and SLC21A3) and OATP-C (also designated OATP2, SLC21A6 and LST1), mediate hepatic uptake of cardiac glycosides. The expression of OATP-C, but not OATP-A, is inducible by phenobarbital and pregnenolone-16a-carbonitrile, resulting in the increased capacity of the liver to extract cardiac glycosides from the plasma. OATP-A is expressed in liver and kidney and helps mediate sodium-independent uptake of the anionic steroid conjugates dehydroepiandrosterone sulfate, estradiol-17-glucuronide and prostaglandin. OATP-C is exclusively expressed in liver and is localized to the basolateral hepatocyte membrane.

Specifications

• Accession Number: P46721
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6579
• Name: Human OATP1 (aa 265-315) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A530084B21; Brain digoxin carrier protein; brain-specific organic anion transporter; membrane transporter; OATP; Oatp1; OATP-1; Oatp1a1; OATP1A2; Oatp1a4; Oatp2; OATPA; OATP-A; OATP-B1; organic anion transporter 2; organic anion transporting polypeptide 1; organic anion transporting polypeptide 1a2; organic anion transporting polypeptide 1a2 variant 1; organic anion transporting polypeptide A; organic anion-transporting polypeptide 1; Slc21a1; SLC21A3; Slc21a5; Slco1a1; SLCO1A2; Slco1a4; SO1A2; Sodium-independent organic anion transporter; sodium-independent organic anion transporter 1; Sodium-independent organic anion-transporting polypeptide 1; sodium-independent organic anion-transporting polypeptide 2; solute carrier family (organic anion transporter) member 1; solute carrier family (organic anion transporter) member 3; solute carrier family 21 (organic anion transporter), member 1; solute carrier family 21 (organic anion transporter), member 3; solute carrier family 21 (organic anion transporter), member 5; solute carrier family 21 member 1; Solute carrier family 21 member 3; solute carrier family 21 member 5; solute carrier family 21, member 1; solute carrier organic anion transporter family member 1A1; Solute carrier organic anion transporter family member 1A2; solute carrier organic anion transporter family member 1A4; solute carrier organic anion transporter family, member 1a1; solute carrier organic anion transporter family, member 1A2; solute carrier organic anion transporter family, member 1a4
• Common Name: OATP1
• Gene Symbol: SLCO1A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining