Invitrogen™ Human OAS3 (aa 302-387) Control Fragment Recombinant Protein

Product Code. 30182749

Brand: Invitrogen™ RP97705

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59539 (PA5-59539. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OAS3 is an interferon inducible protein that belongs to the 2-5A synthetase family, may play a role in mediating resistance to virus infection, control of cell growth, differentiation, and apoptosis. OAS3 synthesizes preferentially dimeric 2',5'-oligoadenylate molecules. GTP can be an alternative substrate. OAS3 binds double-stranded RNA and polymerizes ATP into PPP(A2'P5'A)N oligomers, which activate the latent RNase L that, when activated, cleaves single-stranded RNAs. The protein is present at high level in placenta trophoblast.

Specifications

• Accession Number: Q9Y6K5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4940
• Name: Human OAS3 (aa 302-387) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: (2-5')oligo(A) synthase 3; (2-5')oligo(A) synthetase 3; 2',5'-oligoadenylate synthetase-like 10; 2'-5' oligoadenylate synthetase 3; 2'-5' oligoadenylate synthetase-like 10; 2-5 A synthase 3; 2-5 A synthetase 3; 2'-5'-oligoadenylate synthase 3; 2'-5'-oligoadenylate synthetase 3; 2'-5'-oligoadenylate synthetase 3, 100 kDa; 2'-5'oligoadenylate synthetase p100; Oas3; oasl10; P/OKcl0.4; p100; p100 OAS; p100OAS
• Common Name: OAS3
• Gene Symbol: OAS3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLDPNQKTPENSKSLNAVYPRAGSKPPSCP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining