Invitrogen™ Human NXT2 (aa 31-142) Control Fragment Recombinant Protein

Product Code. 30211514

Brand: Invitrogen™ RP92179

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55010 (PA5-55010. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export.

Specifications

• Accession Number: Q9NPJ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55916
• Name: Human NXT2 (aa 31-142) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330587F24Rik; AI787442; BM-025; DC9; NTF2-related export protein 2; nuclear transport factor 2 like export factor 2; nuclear transport factor 2-like export factor 2; NXT2; P15-2; protein p15-2; RGD1560204
• Common Name: NXT2
• Gene Symbol: NXT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining