Invitrogen™ Human NXNL2 (aa 78-153) Control Fragment Recombinant Protein

Product Code. 30182548

Brand: Invitrogen™ RP98438

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61025 (PA5-61025. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The specific function of NXNL2 remains unknown.

Specifications

• Accession Number: Q5VZ03
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 158046
• Name: Human NXNL2 (aa 78-153) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930519N16Rik; C9orf121; nucleoredoxin like 2; nucleoredoxin-like 2; nucleoredoxin-like protein 2; nucleoredoxin-like protein 2-like; Nxnl2; RdCVF2; rod-derived cone viability factor 2
• Common Name: NXNL2
• Gene Symbol: NXNL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EMLDFMRELHGAWLALPFHDPYRHELRKRYNVTAIPKLVIVKQNGEVITNKGRKQIRERGLACFQDWVEAADIFQN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining