Invitrogen™ Human NUP54 (aa 257-350) Control Fragment Recombinant Protein

Product Code. 30196473

Brand: Invitrogen™ RP96664

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57466 (PA5-57466. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. This gene encodes a member of the phe-gly repeat-containing nucleoporin subset.

Specifications

• Accession Number: Q7Z3B4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 53371
• Name: Human NUP54 (aa 257-350) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110079L04Rik; 54 kDa nucleoporin; 54 kDa; Nuclear pore complex protein Nup54; nucleoporin 54; nucleoporin 54 kD; nucleoporin 54 kDa; nucleoporin Nup54; Nucleoporin p54; NUP54
• Common Name: NUP54
• Gene Symbol: NUP54
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining