missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NUP50 (aa 5-45) Control Fragment Recombinant Protein

Product Code. 30194841
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194841

Brand: Invitrogen™ RP104853

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83907 (PA5-83907. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UKX7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10762
Name Human NUP50 (aa 5-45) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700030K07Rik; 50 kDa nucleoporin; AI413123; CTA-268H5.7; DKFZP564A043; MGC39961; Npap60; NPAP60L; nuclear pore associated protein; nuclear pore associated protein 60 kDa; nuclear pore complex protein Nup50; nuclear pore complex protein Nup50; LOW QUALITY PROTEIN: nuclear pore complex protein Nup50; nuclear pore complex protein nup50-like protein; Nuclear pore-associated protein 60 kDa-like; nuclear pore-associated protein 60 L; nucleoporin 50; nucleoporin 50 kDa; Nucleoporin 50 kDa-like protein; nucleoporin 50 kD; nucleoporin 50 kDa; nucleoporin Nup50; nucleoprotein 50; Nucleoprotein 50 kD; Nup50; NUP50 protein; OTTHUMP00000199530; PRO1146; Rtp60; Unknown (protein for MGC:134469)
Common Name NUP50
Gene Symbol NUP50
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.