missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210289

Invitrogen™ Human NUP43 (aa 176-247) Control Fragment Recombinant Protein

Product Code. 30210289
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210289

Brand: Invitrogen™ RP94722

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55572 (PA5-55572. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NFH3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 348995
Name Human NUP43 (aa 176-247) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610016K01Rik; 2610529I12Rik; AA409950; bA350J20.1; nucleoporin 43; nucleoporin 43 kDa; nucleoporin Nup43; Nup107-160 subcomplex subunit Nup43; Nup43; p42
Common Name NUP43
Gene Symbol NUP43
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.