Invitrogen™ Human NUP35 (aa 89-157) Control Fragment Recombinant Protein

Product Code. 30205109

Brand: Invitrogen™ RP91855

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110837 (PA5-110837. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nucleoporin Nup35 or Mitotic phosphoprotein 44 is a nuclear protein known to be present on nuclear pore complex and is tightly associated with the nuclear membrane and lamina. This RNA associated protein belongs to the Nup53 family and has a MPPN (mitotic phosphoprotein N' end) domain. It has a small number of scattered phenylalanine-glycine repeats, but not the large domains seen in other nucleoporins. Though the exact function of NUP35 is yet to be revealed, it may function as a component of the nuclear pore complex (NPC) which are collectively referred to as nucleoporins (NUPs). It also may play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors, and may also play an important part in the association of MAD1, a transcriptional repressor with the NPC. NUP35 is widely expressed in most of the tissues.

Specifications

• Accession Number: Q8NFH5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 129401
• Name: Human NUP35 (aa 89-157) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310006I24Rik; 35 kDa nucleoporin; 35 kDa; 5330402E05Rik; Mitotic phosphoprotein 44; Mp44; MP-44; NO44; NP44; Nuclear pore complex protein Nup53; nucleoporin 35; nucleoporin 35 kDa; nucleoporin NUP35; Nucleoporin NUP53; Nup35; NUP53
• Common Name: NUP35
• Gene Symbol: NUP35
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining