Invitrogen™ Human NUMBL (aa 328-377) Control Fragment Recombinant Protein

Product Code. 30182778

Brand: Invitrogen™ RP98382

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63564 (PA5-63564. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in the process of neurogenesis. Required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. Not required for the proliferation of neural progenitor cells before the onset of embryonic neurogenesis. Also required postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. Negative regulator of NF-kappa-B signaling pathway. The inhibition of NF-kappa-B activation is mediated at least in part, by preventing MAP3K7IP2 to interact with polyubiquitin chains of TRAF6 and RIPK1 and by stimulating the 'Lys-48'-linked polyubiquitination and degradation of TRAF6 in cortical neurons. [UniProt]

Specifications

• Accession Number: Q9Y6R0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9253
• Name: Human NUMBL (aa 328-377) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CAG3A; CTG3a; NBL; numb homolog (Drosophila)-like; numb homolog-like; NUMB like, endocytic adaptor protein; Numbl; NUMBLIKE; numb-like; numb-like protein; NUMBR; Numb-R; numb-related protein; TNRC23
• Common Name: NUMBL
• Gene Symbol: Numbl
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NELPSTLQRRTDFQVKGTVPEMEPPGAGDSDSINALCTQISSSFASAGAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining