Invitrogen™ Human NuMA (aa 179-278) Control Fragment Recombinant Protein

Product Code. 30203298

Brand: Invitrogen™ RP92564

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82703 (PA5-82703. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NuMA (nuclear mitotic apparatus) is a long coil-coiled protein that plays a role in the interphase and mitosis phases of a cell cycle. In interphase, it has been hypothesized to play a structural role in the nucleoskeleton that may be important in nuclear organization and functions. During mitosis, it is associated with spindle microtubule organization and chromosome positioning.

Specifications

• Accession Number: Q14980
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4926
• Name: Human NuMA (aa 179-278) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6720401E04Rik; AA764025; AL022610; AU014979; centrophilin stabilizes mitotic spindle in mitotic cells; NMP22; NMP-22; Nuclear matrix protein-22; Nuclear mitotic apparatus protein; Nuclear mitotic apparatus protein 1; NUMA; NuMA protein; Numa1; SP-H antigen; structural nuclear protein
• Common Name: NuMA
• Gene Symbol: NUMA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining