Invitrogen™ Human NUDT5 (aa 127-219) Control Fragment Recombinant Protein

Product Code. 30201840

Brand: Invitrogen™ RP92485

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54091 (PA5-54091. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Enzyme that can either act as an ADP-sugar pyrophosphatase in absence of diphosphate or catalyze the synthesis of ATP in presence of diphosphate. In absence of diphosphate, hydrolyzes with similar activities various modified nucleoside diphosphates such as ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP and 8-oxo-dGDP. Can also hydrolyze other nucleotide sugars with low activity. In presence of diphosphate, mediates the synthesis of ATP in the nucleus by catalyzing the conversion of ADP-ribose to ATP and ribose 5-phosphate. Nuclear ATP synthesis takes place when dephosphorylated at Thr-45. Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.

Specifications

• Accession Number: Q9UKK9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11164
• Name: Human NUDT5 (aa 127-219) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8-oxo-dGDP phosphatase; ADP-sugar pyrophosphatase; HSPC115; Nuclear ATP-synthesis protein NUDIX5; Nucleoside diphosphate-linked moiety x motif 5; nudix (nucleoside diphosphate linked moiety X)-type motif 5; nudix hydrolase 5; nudix motif 5; NUDIX5; nudix-type motif 5; NUDT5; YSA1; YSA1H; YSAH1
• Common Name: NUDT5
• Gene Symbol: NUDT5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining