missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NUDT4 (aa 127-180) Control Fragment Recombinant Protein

Produktkode 30209239
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
Förpackningsstorlek
100µL
Denne vare kan ikke returneres. Se returpolitik

Produktkode 30209239

missing translation for 'mfr': Invitrogen™ RP91860

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolitik

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53612 (PA5-53612. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.
TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number Q9NZJ9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11163
Name Human NUDT4 (aa 127-180) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933436C10Rik; Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; diphosphoinositol polyphosphate phosphohydolase type II; diphosphoinositol polyphosphate phosphohydrolase 2; Diphosphoinositol polyphosphate phosphohydrolase NUDT4B; diphosphoinositol polyphosphate phosphohydrolase type 2; DIPP2; DIPP-2; DIPP2alpha; DIPP-2 B; DIPP2beta; DRCF-5; HDCMB47P; KIAA0487; Nucleoside diphosphate-linked moiety x motif 4; Nucleoside diphosphate-linked moiety x motif 4 B; nudix (nucleoside diphosphate linked moiety X)-type motif 4; nudix hydrolase 4; Nudix hydrolase 4 B; Nudix motif 4; Nudix motif 4 B; nudix-type motif 4; NUDT4; NUDT4B; rDIPP2
Common Name NUDT4
Gene Symbol NUDT4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.