Invitrogen™ Human NUDT4 (aa 127-180) Control Fragment Recombinant Protein

Product Code. 30209239

Brand: Invitrogen™ RP91860

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53612 (PA5-53612. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.

Specifications

• Accession Number: Q9NZJ9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11163
• Name: Human NUDT4 (aa 127-180) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933436C10Rik; Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; diphosphoinositol polyphosphate phosphohydolase type II; diphosphoinositol polyphosphate phosphohydrolase 2; Diphosphoinositol polyphosphate phosphohydrolase NUDT4B; diphosphoinositol polyphosphate phosphohydrolase type 2; DIPP2; DIPP-2; DIPP2alpha; DIPP-2 B; DIPP2beta; DRCF-5; HDCMB47P; KIAA0487; Nucleoside diphosphate-linked moiety x motif 4; Nucleoside diphosphate-linked moiety x motif 4 B; nudix (nucleoside diphosphate linked moiety X)-type motif 4; nudix hydrolase 4; Nudix hydrolase 4 B; Nudix motif 4; Nudix motif 4 B; nudix-type motif 4; NUDT4; NUDT4B; rDIPP2
• Common Name: NUDT4
• Gene Symbol: NUDT4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining