missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NUDT21 (aa 21-114) Control Fragment Recombinant Protein

Product Code. 30203145
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203145

Brand: Invitrogen™ RP105588

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67336 (PA5-67336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43809
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11051
Name Human NUDT21 (aa 21-114) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 25 kDa; 3110048P04Rik; 5730530J16Rik; AU014860; AW549947; CFIM25; cleavage and polyadenylation specific factor 5; cleavage and polyadenylation specific factor 5, 25 kD subunit; cleavage and polyadenylation specific factor 5, 25 kDa; cleavage and polyadenylation specificity factor 25 kDa subunit; Cleavage and polyadenylation specificity factor subunit 5; cleavage factor Im complex 25 kDa subunit; CPSF 25 kDa subunit; CPSF25; cpsf5; nucleoside diphosphate-linked moiety x motif 21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; nudix hydrolase 21; Nudix motif 21; Nudt21; pre-mRNA cleavage factor Im (25 kD); pre-mRNA cleavage factor Im 25 kDa subunit; Pre-mRNA cleavage factor Im 68 kDa subunit; pre-mRNA cleavage factor Im, 25 kD subunit; similar to cleavage and polyadenylation specific factor 5, 25 kDa; zgc:63966
Common Name NUDT21
Gene Symbol NUDT21
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.