Invitrogen™ Human NUDT21 (aa 116-216) Control Fragment Recombinant Protein

Product Code. 30202662

Brand: Invitrogen™ RP91756

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54101 (PA5-54101. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.

Specifications

• Accession Number: O43809
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11051
• Name: Human NUDT21 (aa 116-216) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 25 kDa; 3110048P04Rik; 5730530J16Rik; AU014860; AW549947; CFIM25; cleavage and polyadenylation specific factor 5; cleavage and polyadenylation specific factor 5, 25 kD subunit; cleavage and polyadenylation specific factor 5, 25 kDa; cleavage and polyadenylation specificity factor 25 kDa subunit; Cleavage and polyadenylation specificity factor subunit 5; cleavage factor Im complex 25 kDa subunit; CPSF 25 kDa subunit; CPSF25; cpsf5; nucleoside diphosphate-linked moiety x motif 21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; nudix hydrolase 21; Nudix motif 21; Nudt21; pre-mRNA cleavage factor Im (25 kD); pre-mRNA cleavage factor Im 25 kDa subunit; Pre-mRNA cleavage factor Im 68 kDa subunit; pre-mRNA cleavage factor Im, 25 kD subunit; similar to cleavage and polyadenylation specific factor 5, 25 kDa; zgc:63966
• Common Name: NUDT21
• Gene Symbol: NUDT21
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining