Invitrogen™ Human NUDT2 (aa 1-57) Control Fragment Recombinant Protein

Product Code. 30204125

Brand: Invitrogen™ RP103834

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66189 (PA5-66189, PA5-64332 (PA5-64332. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified.

Specifications

• Accession Number: P50583
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 318
• Name: Human NUDT2 (aa 1-57) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310051L06Rik; AA939917; Ap4A hydrolase; Ap4A hydrolase 1; Ap4Aase; APAH1; bis(5'-nucleosyl)-tetraphosphatase; bis(5'-nucleosyl)-tetraphosphatase (asymmetrical); bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]; Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase; diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase; diadenosine tetraphosphatase; MGC10404; nucleoside diphosphate-linked moiety x motif 2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; nudix hydrolase 2; nudix motif 2; Nudt2
• Common Name: NUDT2
• Gene Symbol: NUDT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining