missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200467

Invitrogen™ Human NUDT15 (aa 86-164) Control Fragment Recombinant Protein

Product Code. 30200467
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200467

Brand: Invitrogen™ RP102861

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58614 (PA5-58614. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mediates the hydrolysis of some nucleoside diphosphate derivatives. Can degrade 8-oxo-dGTP in vitro, suggesting that it may remove an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool, thereby preventing misincorporation of 8-oxo-dGTP into DNA thus preventing A:T to C:G transversions. Its substrate specificity in vivo however remains unclear. May have a role in DNA synthesis and cell cycle progression throught the interaction with PCNA.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NV35
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55270
Name Human NUDT15 (aa 86-164) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6530403O17; 7,8-dihydro-8-oxoguanine-triphosphatase NUDT15; 8-oxo-dGTPase NUDT15; A730068G11Rik; mMTH2; MTH2; MutT homolog 2; nucleoside diphosphate-linked moiety x motif 15; Nucleoside diphosphate-linked to another moiety x hydrolase 15; Nucleotide triphosphate diphosphatase NUDT15; nudix (nucleoside diphosphate linked moiety X)-type motif 15; nudix hydrolase 15; Nudix motif 15; nudix-type motif 15; NUDT15; NUDT15D; probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15; probable 8-oxo-dGTP diphosphatase NUDT15; RP11-90M2.1
Common Name NUDT15
Gene Symbol NUDT15
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.