missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181551

Invitrogen™ Human NUDT14 (aa 122-214) Control Fragment Recombinant Protein

Product Code. 30181551
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181551

Brand: Invitrogen™ RP97612

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61308 (PA5-61308. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UDP-glucose (UDPG) acts as the sugar donor in numerous glycosylation reactions, including those involved in the production of glycogen. NUDT14 is a UDPG pyrophosphatase (EC 3.6.1.45) that hydrolyzes UDPG to produce glucose 1-phosphate and UMP (Yagi et al., 2003 [PubMed 12429023]).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95848
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 256281
Name Human NUDT14 (aa 122-214) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110030M18Rik; nucleoside diphosphate-linked moiety x motif 14; nudix (nucleoside diphosphate linked moiety X)-type motif 14; nudix hydrolase 14; nudix motif 14; nudix-type motif 14; NUDT14; UDPG pyrophosphatase; UDP-sugar diphosphatase; UGPP; UGPPase; uridine diphosphate glucose pyrophosphatase; Uridine diphosphate glucose pyrophosphatase NUDT14; uridine diphosphate glucose pyrophosphatase NUDT14; uridine diphosphate glucose pyrophosphatase
Common Name NUDT14
Gene Symbol NUDT14
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.