Invitrogen™ Human NUDCD2 (aa 66-152) Control Fragment Recombinant Protein

Product Code. 30197700

Brand: Invitrogen™ RP102761

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57930 (PA5-57930. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NUDCD2 may regulate the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone.

Specifications

• Accession Number: Q8WVJ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 134492
• Name: Human NUDCD2 (aa 66-152) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D11Ertd603e; NudC domain containing 2; nudC domain-containing protein 2; Nudcd2; NudCL2; NudC-like protein 2; RGD1307203
• Common Name: NUDCD2
• Gene Symbol: Nudcd2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining