Invitrogen™ Human NUDC (aa 1-77) Control Fragment Recombinant Protein

Product Code. 30198665

Brand: Invitrogen™ RP94045

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83001 (PA5-83001. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NudC was first identified as a regulator of nuclear movement in the asexual reproductive cycle of the filamentous fungus Aspergillus nidulans. Human NUDC is a nuclear movement protein that associates with dynein.

Specifications

• Accession Number: Q9Y266
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10726
• Name: Human NUDC (aa 1-77) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: c15; clone 15; H M NPD011; HNUDC; MNUDC; MNUDC protein; NPD011; nuclear distribution C homolog; nuclear distribution C, dynein complex regulator; nuclear distribution gene C homolog; nuclear distribution gene C homolog (Aspergillus); nuclear distribution protein C homolog; Nuclear migration protein nudC; Nudc; nudC nuclear distribution protein; OTTHUMP00000004405; SIG-92; Silg92; silica-induced gene 92 protein
• Common Name: NUDC
• Gene Symbol: NUDC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining