Invitrogen™ Human NUCKS1 (aa 138-187) Control Fragment Recombinant Protein

Product Code. 30211564

Brand: Invitrogen™ RP103854

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64016 (PA5-64016. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated in vivo by Cdk1 during mitosis of the cell cycle.

Specifications

• Accession Number: Q9H1E3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64710
• Name: Human NUCKS1 (aa 138-187) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700010L10Rik; 8430423A01Rik; AI647518; C78391; cyclin-dependent kinase substrate; JC7; Nucks; NUCKS1; nuclear casein kinase and cyclin dependent kinase substrate 1; nuclear casein kinase and cyclin-dependent kinase substrate 1; nuclear ubiquitous casein and cyclin-dependent kinase substrate 1; nuclear ubiquitous casein and cyclin-dependent kinases substrate; nuclear ubiquitous casein kinase 2; nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate; nuclear, casein kinase and cyclin-dependent kinase substrate; P1; potential LAG1 interactor
• Common Name: NUCKS1
• Gene Symbol: Nucks1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining