Invitrogen™ Human NTAL (aa 33-175) Control Fragment Recombinant Protein

Product Code. 30202239

Brand: Invitrogen™ RP102142

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82095 (PA5-82095. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NTAL (Non-T cell Activation Linker), also known as LAB (Linker for activation of B cells), is a 30 kDa double-palmitoylated transmembrane adaptor protein expressed by B cells, NK cells, mast cells and macrophages. It is a negative regulator of early stages of BCR-dependent B cell signaling and serves as a negative regulator also in mast cells. However, in mast cells, NTAL also contributes to some activation processes, partially overlapping with LAT function.

Specifications

• Accession Number: Q9GZY6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7462
• Name: Human NTAL (aa 33-175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW125574; HSPC046; LAB; Lat2; LAT-2 like; Linker for activation of B-cells; linker for activation of T cells family, member 2; linker for activation of T cells, transmembrane adaptor 2; linker for activation of T-cells family member 2; Membrane-associated adapter molecule; non-T cell activation linker; non-T-cell activation linker; NTAL; WBS15; WBSCR15; WBSCR5; Williams-Beuren syndrome chromosomal region 15 protein; williams-Beuren syndrome chromosomal region 15 protein homolog; Williams-Beuren syndrome chromosomal region 5 protein; Williams-Beuren syndrome chromosome region 5 homolog; Williams-Beuren syndrome chromosome region 5-like protein; WSCR5
• Common Name: NTAL
• Gene Symbol: LAT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining