Invitrogen™ Human NT5C3A (aa 61-185) Control Fragment Recombinant Protein

Product Code. 30204312

Brand: Invitrogen™ RP90171

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56052 (PA5-56052. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pyrimidine 5-prime-nucleotidase (P5N), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology.

Specifications

• Accession Number: Q9H0P0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51251
• Name: Human NT5C3A (aa 61-185) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1600024P05Rik; 2610206B05Rik; 3110004A18Rik; 5'-nucleotidase, cytosolic III; 5'-nucleotidase, cytosolic IIIA; 5'-nucleotidase, pyrimidine; 7-methylguanosine nucleotidase; 7-methylguanosine phosphate-specific 5'-nucleotidase; AI842776; cN-III; Cytosolic 5'-nucleotidase 3; cytosolic 5'-nucleotidase 3 A; Cytosolic 5'-nucleotidase III; fb30h07; HSPC233; hUMP1; lupin; MGC27337; MGC87109; MGC87828; nt5c3; Nt5c3a; Nt5y; p36; P5N1; P5'N-1; P5N-1; PN-1; PN-I; POMP; PSN1; pyrimidine 5'-nucleotidase; pyrimidine 5'-nucleotidase 1; UMPH; UMPH1; Umph-1; Unknown (protein for MGC:133762); uridine 5'-monophosphate hydrolase 1; uridine monophosphatase 1; wu:fb30h07; zgc:66117
• Common Name: NT5C3A
• Gene Symbol: NT5C3A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining