missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200300

Invitrogen™ Human NSUN6 (aa 95-187) Control Fragment Recombinant Protein

Product Code. 30200300
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200300

Brand: Invitrogen™ RP97123

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61119 (PA5-61119. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NSun6 is an RNA methyltransferase that catalyzes the methylation at position cytosine C72 in some tRNAs. NSUN6 has been reported to localize to the cytoplasm and largely colocalize with Golgi apparatus and pericentriolar matrix, indicating that NSUN6 modifies tRNAs in a late step in their biogenesis. NSun6 may also play a major role in bone metastasis and could be a valuable therapeutic target for bone metastasis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TEA1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 221078
Name Human NSUN6 (aa 95-187) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933403D21Rik; 4933414E04Rik; ARL5B antisense RNA 1; ARL5B-AS1; NOL1/NOP2/Sun and PUA domain-containing protein 1; NOL1/NOP2/Sun domain family 6; NOL1/NOP2/Sun domain family member 6; NOL1/NOP2/Sun domain family, member 6; NOP2/Sun domain family, member 6; NOP2/Sun RNA methyltransferase family member 6; NOPD1; NSUN6; nucleolar protein (NOL1/NOP2/sun) and PUA domains 1; putative methyltransferase NSUN6
Common Name NSUN6
Gene Symbol NSUN6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.