Invitrogen™ Human NSUN5 (aa 133-210) Control Fragment Recombinant Protein

Product Code. 30210082

Brand: Invitrogen™ RP91740

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54228 (PA5-54228. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NSUN5 is a member of the evolutionarily conserved NOL1/NOP2/Sun domain family. The encoded protein may function as a DNA methyltransferase in the nucleus. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q96P11
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55695
• Name: Human NSUN5 (aa 133-210) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9830109N13Rik; AI326939; FLJ10267; MGC986; NOL1; NOL1/NOP2/Sun domain family member 5; NOL1/NOP2/Sun domain family, member 5; NOL1R; NOL1-related protein; NOP2/Sun domain family, member 5; NOP2/Sun domain family, member 5 A; NOP2/Sun RNA methyltransferase family member 5; Nsun5; NSUN5A; p120; p120(NOL1); Probable 28 S rRNA (cytosine-C(5))-methyltransferase; putative methyltransferase NSUN5; RGD1309268; WBSCR20; Wbscr20a; Williams Beuren syndrome chromosome region 20 A; Williams Beuren syndrome chromosome region 20 A homolog; Williams-Beuren syndrome chromosomal region 20 A protein; Williams-Beuren syndrome chromosomal region 20 A protein homolog; Williams-Beuren syndrome critical region protein 20; Williams-Beuren syndrome critical region protein 20 copy A
• Common Name: NSUN5
• Gene Symbol: Nsun5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining