Invitrogen™ Human NSG2 (aa 111-171) Control Fragment Recombinant Protein

Product Code. 30204063

Brand: Invitrogen™ RP96576

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63263 (PA5-63263. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NSG2 is a protein coding gene. Gene ontology (GO) annotation include cytoplasmic vesicle membrane; dendrite; early endosome; early endosome membrane; endosome; Golgi apparatus; Golgi cis cisterna membrane; integral component of membrane; late endosome; lysosomal lumen; multivesicular body membrane; trans-Golgi network membrane.

Specifications

• Accession Number: Q9Y328
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51617
• Name: Human NSG2 (aa 111-171) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CALY3; HMP19; HMP19 protein; hypothalamus golgi apparatus expressed 19 kDa protein; neuron specific gene family member 2; Neuronal vesicle trafficking-associated protein 2; neuron-specific protein family member 2; NSG2; p19 protein; protein 8.5; Protein p19
• Common Name: NSG2
• Gene Symbol: NSG2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining