Invitrogen™ Human NSFL1C (aa 87-158) Control Fragment Recombinant Protein

Product Code. 30181548

Brand: Invitrogen™ RP99300

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62224 (PA5-62224. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

p47, also known as NSFL1C, UBX1, UBXD10 or UBXN2C, is a 370 amino acid protein that localizes to both the nucleus and the golgi apparatus (specifically to golgi stacks) and contains one SEP domain and one UBX domain. Functioning as part of a ternary complex with VCP (a protein involved in the heterotypic fusion of transport vesicles with their target membranes) and Syntaxin 5, p47 interacts with and reduces the ATPase activity of VCP and is required for the fragmentation of golgi stacks during mitosis and for subsequent reassembly of golgi stacks after mitosis. p47 is subject to phosphorylation during mitosis, which inhibits p47-golgi interaction and is, therefore, required for proper golgi stack formation and cisternal regrowth. Human p47 shares 89% sequence identity with its mouse counterpart, suggesting a conserved role between species. Multiple isoforms of p47 exist due to alternative splicing events.

Specifications

• Accession Number: Q9UNZ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55968
• Name: Human NSFL1C (aa 87-158) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: dJ776F14.1; Munc-18 c; NSFL1 (p97) cofactor (p47); NSFL1 cofactor; NSFL1 cofactor p47; NSFL1C; p47; p97 cofactor p47; RP4-776F14.2; SHP1 homolog; Stxbp3a; UBX domain-containing protein 2 C; UB x 1; UBXD10; UBXN2C; XY body-associated protein XY40; XY40
• Common Name: NSFL1C
• Gene Symbol: Nsfl1c
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining