Invitrogen™ Human NSD2 (aa 30-146) Control Fragment Recombinant Protein

Product Code. 30200964

Brand: Invitrogen™ RP91616

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53385 (PA5-53385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences.

Specifications

• Accession Number: O96028
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7468
• Name: Human NSD2 (aa 30-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830445G22Rik; 9430010A17Rik; AW555663; C130020C13Rik; D030027O06Rik; D930023B08Rik; Histone-lysine N-methyltransferase NSD2; histone-lysine N-methyltransferase NSD2; LOW QUALITY PROTEIN: histone-lysine N-methyltransferase NSD2; IL5 promoter REII region-binding protein; Kiaa1090; LOW QUALITY PROTEIN: histone-lysine N-methyltransferase NSD2; mKIAA1090; MMSET; multiple myeloma SET domain containing protein type III; multiple myeloma SET domain-containing protein; NSD2; nuclear receptor binding SET domain protein 2; nuclear SET domain-containing protein 2; probable histone-lysine N-methyltransferase NSD2; Protein trithorax-5; putative histone-lysine N-methyltransferase NSD2-like protein; REIIBP; RGD1565590; trithorax/ash1-related protein 5; TR x 5; WHS; Whsc1; Whsc1l; Wolf-Hirschhorn syndrome candidate 1; Wolf-Hirschhorn syndrome candidate 1 (human); Wolf-Hirschhorn syndrome candidate 1 protein; Wolf-Hirschhorn syndrome candidate 1 protein homolog
• Common Name: NSD2
• Gene Symbol: NSD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining