Invitrogen™ Human NSD1 (aa 659-747) Control Fragment Recombinant Protein

Product Code. 30196800

Brand: Invitrogen™ RP108623

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84938 (PA5-84938. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein containing a SET domain, 2 LXXLL motifs, 3 nuclear translocation signals (NLSs), 4 plant homeodomain (PHD) finger regions, and a proline-rich region. The encoded protein enhances androgen receptor (AR) transactivation, and this enhancement can be increased further in the presence of other androgen receptor associated coregulators. This protein may act as a nucleus-localized, basic transcriptional factor and also as a bifunctional transcriptional regulator. Mutations of this gene have been associated with Sotos syndrome and Weaver syndrome. One version of childhood acute myeloid leukemia is the result of a cryptic translocation with the breakpoints occurring within nuclear receptor-binding Su-var, enhancer of zeste, and trithorax domain protein 1 on chromosome 5 and nucleoporin, 98-kd on chromosome 11. Two transcript variants encoding distinct isoforms have been identified for this gene.

Specifications

• Accession Number: Q96L73
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64324
• Name: Human NSD1 (aa 659-747) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI528500; Androgen receptor coactivator 267 kDa protein; androgen receptor-associated coregulator 267; androgen receptor-associated protein of 267 kDa; ARA267; H3-K36-HMTase; H4-K20-HMTase; Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific; KMT3B; Lysine N-methyltransferase 3 B; NR-binding SET domain-containing protein; NSD1; nuclear receptor binding SET domain protein 1; nuclear receptor-binding SET domain-containing protein 1; nuclear receptor-binding SET-domain protein 1; SOTOS; SOTOS1; STO
• Common Name: NSD1
• Gene Symbol: NSD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDLKASTLVHKPQSDFT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining