missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NSD1 (aa 1105-1185) Control Fragment Recombinant Protein

Product Code. 30196298
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196298

Brand: Invitrogen™ RP107743

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67097 (PA5-67097. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein containing a SET domain, 2 LXXLL motifs, 3 nuclear translocation signals (NLSs), 4 plant homeodomain (PHD) finger regions, and a proline-rich region. The encoded protein enhances androgen receptor (AR) transactivation, and this enhancement can be increased further in the presence of other androgen receptor associated coregulators. This protein may act as a nucleus-localized, basic transcriptional factor and also as a bifunctional transcriptional regulator. Mutations of this gene have been associated with Sotos syndrome and Weaver syndrome. One version of childhood acute myeloid leukemia is the result of a cryptic translocation with the breakpoints occurring within nuclear receptor-binding Su-var, enhancer of zeste, and trithorax domain protein 1 on chromosome 5 and nucleoporin, 98-kd on chromosome 11. Two transcript variants encoding distinct isoforms have been identified for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96L73
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64324
Name Human NSD1 (aa 1105-1185) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI528500; Androgen receptor coactivator 267 kDa protein; androgen receptor-associated coregulator 267; androgen receptor-associated protein of 267 kDa; ARA267; H3-K36-HMTase; H4-K20-HMTase; Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific; KMT3B; Lysine N-methyltransferase 3 B; NR-binding SET domain-containing protein; NSD1; nuclear receptor binding SET domain protein 1; nuclear receptor-binding SET domain-containing protein 1; nuclear receptor-binding SET-domain protein 1; SOTOS; SOTOS1; STO
Common Name NSD1
Gene Symbol NSD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENSEC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.