Invitrogen™ Human NRSN1 (aa 140-195) Control Fragment Recombinant Protein

Product Code. 30195940

Brand: Invitrogen™ RP101823

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63920 (PA5-63920. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play an important role in neural organelle transport, and in transduction of nerve signals or in nerve growth. May play a role in neurite extension. May play a role in memory consolidation. [UniProt]

Specifications

• Accession Number: Q8IZ57
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 140767
• Name: Human NRSN1 (aa 140-195) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: neurensin 1; neurensin-1; Neuro-p24; nrsn1; p24; vesicular membrain protein p24; vesicular membrane protein of 24 kDa; Vesicular membrane protein p24; Vmp
• Common Name: NRSN1
• Gene Symbol: NRSN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining