Invitrogen™ Human NRIP2 (aa 44-94) Control Fragment Recombinant Protein

Product Code. 30181230

Brand: Invitrogen™ RP97635

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58954 (PA5-58954. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NRIP2 down-regulates transcriptional activation by nuclear receptors such as NR1F2.

Specifications

• Accession Number: Q9BQI9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83714
• Name: Human NRIP2 (aa 44-94) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW491344; DKFZP761G1913; fj77f06; neuronal interacting factor 1; neuronal-interacting factor x 1; Nix1; Nrip2; nuclear receptor interacting protein 2; nuclear receptor interacting protein 2-like; nuclear receptor-interacting protein 2; si:dkey-245f7.1; similar to nuclear receptor interacting protein 2; wu:fj77f06
• Common Name: NRIP2
• Gene Symbol: NRIP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTPPAGAMSTKQEARRDEGEARTRGQEAQLRDRAHLSQQRRLKQATQFLHK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining