Invitrogen™ Human NREP (aa 3-57) Control Fragment Recombinant Protein

Product Code. 30205362

Brand: Invitrogen™ RP93717

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51408 (PA5-51408. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

P311, also known as C5orf13 (chromosome 5 open reading frame 13), D4S114, PTZ17 or PRO1873, is a 68 amino acid cytoplasmic protein involved in cellular differentiation, neural function and axonal regeneration. Found in the granular layer of the cerebellum, P311 is expressed at lower levels in hippocampus, olfactory bulb, kidney, liver and heart and when expressed ectopically, P311 augments giloma motility. P311 is enriched in mice within the superficial cortical layers and striatum at E20 and the germinal zones at E17. Known to interact with Filamin 1, P311 regulates retinoic-acid lipid-droplet biogenesis, induces myofibroblast ameboid migration and the differentiation of fibroblasts into myofibroblasts. Ser-59 phosphorylation decreases P311 stability; the gene encoding P311 maps to human chromosome 5q22.1.

Specifications

• Accession Number: Q16612
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9315
• Name: Human NREP (aa 3-57) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI325076; C5orf13; D0H4S114; D4S114; Harp; high-altitude regulated protein; neuronal protein 3.1; neuronal regeneration related protein; neuronal regeneration related protein homolog; neuronal regeneration-related protein; Nrep; P311; PRO1873; Protein p311; PTZ17; SEZ17
• Common Name: NREP
• Gene Symbol: NREP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining