Invitrogen™ Human NR4A1 (aa 361-411) Control Fragment Recombinant Protein

Product Code. 30206879

Brand: Invitrogen™ RP108563

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NR4A1 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. NGFI-B-alpha is expressed in brain, adrenal, thyroid, liver, testis, ovary, thymus, muscle, lung and prostate. Its expression is induced in response to various stress stimuli and growth factors. The encoded protein acts as a nuclear transcription factor involved in mediating apoptotic signaling in thymocytes and tumor cells, as well as having a role in signaling in the hypothalamic-pituitary axis. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Three transcript variants encoding two distinct isoforms have been identified for this NR4A1. Variant (3), also known as TRC beta, contains multiple differences compared to variant 1. The resulting isoform b contains a shorter and distinct C-terminus compared to isoform a. RXR has been shown to be a partner for NR4A1.

Specifications

• Accession Number: P22736
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3164
• Name: Human NR4A1 (aa 361-411) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: early response protein NAK1; Gfrp; GFRP1; growth factor-inducible nuclear protein N10; Hbr1; Hbr-1; Hmr; hormone receptor; immediate early gene transcription factor NGFI-B; MGC9485; N10; NAK1; NAK-1; nerve growth factor IB nuclear receptor variant 1; nerve growth factor induced protein I-B; nerve growth factor-induced protein I-B; Ngfib; NGFI-B; NP10; Nr4a1; Nuclear hormone receptor NUR/77; nuclear protein N10; Nuclear receptor subfamily 4 group A member 1; nuclear receptor subfamily 4, group A, member 1; NUR77; Orphan nuclear receptor HMR; orphan nuclear receptor TR3; Orphan receptor tr3; ST-59; steroid receptor TR3; testicular receptor 3; TIS1; TR3; TR3 orphan receptor
• Common Name: NR4A1 (Nur77)
• Gene Symbol: NR4A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining