Invitrogen™ Human NR2C2AP (aa 79-139) Control Fragment Recombinant Protein

Product Code. 30181107

Brand: Invitrogen™ RP99192

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59846 (PA5-59846. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.

Specifications

• Accession Number: Q86WQ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 126382
• Name: Human NR2C2AP (aa 79-139) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310073E15Rik; Nr2c2ap; nuclear receptor 2C2 associated protein; nuclear receptor 2C2-associated protein; repressor for TR4 transactivation; TR4 orphan receptor associated protein TRA16; TR4 orphan receptor-associated 16 kDa protein; TRA16
• Common Name: NR2C2AP
• Gene Symbol: NR2C2AP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining