Invitrogen™ Human NQO1 (aa 138-273) Control Fragment Recombinant Protein

Product Code. 30206894

Brand: Invitrogen™ RP88713

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82294 (PA5-82294. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NQO1 is a member of the NAD(P)H dehydrogenase (quinone) family and a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. NQO1's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Altered expression of the protein has been seen in many tumors and is also associated with Alzheimer's disease (AD).

Specifications

• Accession Number: P15559
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1728
• Name: Human NQO1 (aa 138-273) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV001255; Azoreductase; DHQU; DIA4; Diaphorase (NADH/NADPH); diaphorase (NADH/NADPH) (cytochrome b-5 reductase); Diaphorase 4; diaphorase 4 (NADH/NADPH); diaphorase-4; dioxin-inducible 1; DTD; DT-diaphorase; menadione reductase; NAD(P)H dehydrogenase (quinone); NAD(P)H dehydrogenase [quinone] 1; NAD(P)H dehydrogenase, quinone 1; NAD(P)H menadione oxidoreductase 1, dioxin inducible; NAD(P)H quinone dehydrogenase 1; NAD(P)H: quinone oxidoreductase 1; NAD(P)H:menadione oxidoreductase; NAD(P)H:menadione oxidoreductase 1; NAD(P)H:Quinone acceptor oxidoreductase type 1; NAD(P)H:quinone oxidoreductase 1; NAD(P)H:quinone oxireductase; NADPH-d; nicotinamide adenine dinucleotide phosphate diaphorase; Nmo1; Nmo-1; Nmor1; NMORI; NQ01; NQO1; O x 1; Ox-1; phylloquinone reductase; QR1; quinone reductase 1
• Common Name: NQO1
• Gene Symbol: NQO1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining