Invitrogen™ Human NPW (aa 85-154) Control Fragment Recombinant Protein

Product Code. 30212298

Brand: Invitrogen™ RP107381

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66729 (PA5-66729. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NPW is processed into 23- and 30-amino acid neuropeptides that bind and activate two G-protein coupled receptors in the central nervous system. The neuropeptides have been shown to enhance cortisol secretion from adrenal cells through the adenylate cyclase/protein kinase A signaling cascade. The preproprotein is translated using a non-AUG initiation codon that is inferred from analyses of the mouse ortholog.

Specifications

• Accession Number: Q8N729
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 283869
• Name: Human NPW (aa 85-154) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Gm935; hPPL8; L8; L8C; Neuropeptide W; Neuropeptide W-23; Neuropeptide W-30; NPW; NPW23; NPW30; PP PPNPW; Ppl8; PPNPW; prepro-neuropeptide W; prepro-Neuropeptide W polypeptide; preproprotein L8
• Common Name: NPW
• Gene Symbol: NPW
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDPAANR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining