Invitrogen™ Human NPLOC4 (aa 395-517) Control Fragment Recombinant Protein

Product Code. 30206316

Brand: Invitrogen™ RP93491

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54450 (PA5-54450. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NPLOC4 gene ontology annotations related to this gene include ubiquitin-dependent protein catabolic process.

Specifications

• Accession Number: Q8TAT6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55666
• Name: Human NPLOC4 (aa 395-517) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AK129375; FLJ20657; homolog of yeast nuclear protein localization 4; KIAA1499; mKIAA1499; NPL4; NPL4 homolog, ubiquitin recognition factor; Nploc4; NPLOC4 ubiquitin recognition factor; nuclear protein localization 4 homolog; nuclear protein localization 4 homolog (S. cerevisiae); nuclear protein localization protein 4 homolog; Protein NPL4
• Common Name: NPLOC4
• Gene Symbol: NPLOC4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining